The domain within your query sequence starts at position 127 and ends at position 404; the E-value for the Glyco_hydro_85 domain shown below is 2.6e-101.

YLEDRFIQGSEVQNPYSFYHWQYIDIFVYFSHHTVTIPPVCWTNAAHRHGVCVLGTFITE
WQEGGRLCEAFLAGDEPSFQAVADRLVQIAQFFRFDGWLINIENSLTPAAVRNTPLFLQY
LTAQLHQQVPGGLVLWYDSVVQSGQLKWQDELNDQNRVFFDSCDGFFTNYNWREDHLQRM
VAQAGERLADVYVGVDVFARSNVVGGRFDTDKSLELIRKHGFSAALFAPGWVYECLEKSD
FFQNQDKFWSLLERFLPTHSICSLPFVTSFCLGLGTRR

Glyco_hydro_85

Glyco_hydro_85
PFAM accession number:PF03644
Interpro abstract (IPR005201):

O-Glycosyl hydrolases (EC 3.2.1.) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [(PUBMED:7624375), (PUBMED:8535779)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.

This group of endo-beta-N-acetylglucosaminidases belong to the glycoside hydrolase family 85 . These enzymes work on a broad spectrum of substrates.

GO component:cytoplasm (GO:0005737)
GO function:mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity (GO:0033925)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_hydro_85