The domain within your query sequence starts at position 91 and ends at position 201; the E-value for the Glyco_tran_10_N domain shown below is 8.8e-37.
QSTLTILIWHWPFTNRPPELPGDTCTRYGMASCRLSANRSLLASADAVVFHHRELQTRQS LLPLDQRPHGQPWVWASMESPSNTHGLHRFRGIFNWVLSYRRDSDIFVPYG
Glyco_tran_10_N |
---|
PFAM accession number: | PF17039 |
---|---|
Interpro abstract (IPR031481): | This is the N-terminal domain of a family of fucosyltransferases, known as glycosyltransferase family 10 [ (PUBMED:9334165) (PUBMED:17251184) ]. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage [ (PUBMED:9451017) ]. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_tran_10_N