The domain within your query sequence starts at position 91 and ends at position 201; the E-value for the Glyco_tran_10_N domain shown below is 8.8e-37.

QSTLTILIWHWPFTNRPPELPGDTCTRYGMASCRLSANRSLLASADAVVFHHRELQTRQS
LLPLDQRPHGQPWVWASMESPSNTHGLHRFRGIFNWVLSYRRDSDIFVPYG

Glyco_tran_10_N

Glyco_tran_10_N
PFAM accession number:PF17039
Interpro abstract (IPR031481):

This is the N-terminal domain of a family of fucosyltransferases, known as glycosyltransferase family 10 [(PUBMED:9334165), (PUBMED:17251184)]. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage [(PUBMED:9451017)]. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_tran_10_N