The domain within your query sequence starts at position 548 and ends at position 751; the E-value for the Glyco_tranf_2_2 domain shown below is 1.2e-10.

RFMGNFEKTCLIPNLNVKLVILLFNSDSNPDKAKQVELMRDYRVKYPKADMQVLPVSGGF
SRALALEVGSSQFNNESLLFFCDVDLVFTAEFLQRCRANTVLGQQIYFPIIFSQYDPKIV
YSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLEDVDLFNKVV
QAGLKTFRSQEVGVVHIHHPVVCD

Glyco_tranf_2_2

Glyco_tranf_2_2
PFAM accession number:PF10111
Interpro abstract (IPR019290):

This entry represetns a predicted glycosyltransferase domain found in a set of prokaryotic proteins that includes putative glucosyltransferases involved in bacterial capsule biosynthesis [(PUBMED:9515923), (PUBMED:11953367)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_tranf_2_2