The domain within your query sequence starts at position 191 and ends at position 362; the E-value for the Glyco_transf_17 domain shown below is 3.2e-28.
VVQYSNLPTKERLVPREVPRRVINAININHEFDLLDVRFHELGDVVDAFVVCESNFTAYG EPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDGVSRLRN LRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGT
Glyco_transf_17 |
 |
|---|
| PFAM accession number: | PF04724 |
|---|---|
| Interpro abstract (IPR006813): | This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase ( EC 2.4.1.144 ). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumour progression [ (PUBMED:11986323) (PUBMED:11784313) ]. |
| GO process: | protein N-linked glycosylation (GO:0006487) |
| GO component: | membrane (GO:0016020) |
| GO function: | beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity (GO:0003830) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_17