The domain within your query sequence starts at position 191 and ends at position 362; the E-value for the Glyco_transf_17 domain shown below is 3.2e-28.

VVQYSNLPTKERLVPREVPRRVINAININHEFDLLDVRFHELGDVVDAFVVCESNFTAYG
EPRPLKFREMLTNGTFEYIRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTQDGVSRLRN
LRPDDVFIIDDADEIPARDGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGT

Glyco_transf_17

Glyco_transf_17
PFAM accession number:PF04724
Interpro abstract (IPR006813): This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC 2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumour progression [(PUBMED:11986323), (PUBMED:11784313)].
GO process:protein N-linked glycosylation (GO:0006487)
GO component:membrane (GO:0016020)
GO function:beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity (GO:0003830)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_17