The domain within your query sequence starts at position 184 and ends at position 777; the E-value for the Glyco_transf_18 domain shown below is 3.5e-269.

CYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAARTAPKSLPRVQAVFRSNLSHLLEL
MGSGKESLIFMKKRTRRFTAQWTKAAKYLAQKLGDIRRDQKQILVHIGFLTEESGDVFSP
RVLKGGPLGEMVQWADILAALYVLGHSLRITVSLKELQSNLGVPPGRGNCPLTVPLPFDL
IYTDYHGLQQMKQHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTNWGYWNLNP
KQFMTMFPHTPDNSFMGFVSEELNETEKQLIKDGKASNMAVVYGKEASIWKLQGKEKFLA
VLNKYMEIHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPL
EAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSD
EFETAIKAIMNTQVDPYLPYEYTCAGMLERINAYIQHQDFCVGPSPLPPGASTAQSPFVL
APNATHLEWAQNISSVPGAWPPTHSLRAWLAAPGRACTDACLDHGLICEPSFFPFLNSQN
SFLKLQVPCDSTEWEMHHLYPAFAQPGQECYLQKEPLLFSCAGASTKYQRLCPC

Glyco_transf_18

Glyco_transf_18
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_18