The domain within your query sequence starts at position 106 and ends at position 278; the E-value for the Glyco_transf_21 domain shown below is 8.4e-61.

PNVDARLFIGGKKVGINPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKV
GLVHGLPYVADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGG
LIAFAQYIAEDYFMAKAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTK

Glyco_transf_21

Glyco_transf_21
PFAM accession number:PF13506
Interpro abstract (IPR025993):

This is a family of ceramide beta-glucosyltransferases (EC 2.4.1.80), which catalyse the transfer of glucose to ceramide, the first glycosylation step in glycosphingolipid biosynthesis [(PUBMED:8643456), (PUBMED:10393098)]. They belong to the glycosyl transferase family 21.

GO function:transferase activity, transferring glycosyl groups (GO:0016757)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_21