The domain within your query sequence starts at position 90 and ends at position 373; the E-value for the Glyco_transf_29 domain shown below is 2.9e-66.

LLWEGLFTQELWNNLSQHKVPYGWQGLSHEVIASTLRLLKSPESGELFGAPRKLPLSCIR
CAVVGNGGILNGSRQGQKIDAHDYVFRLNGAITEGFERDVGTKTSFYGFTVNTMKNSLIS
YAKLGFTSVPQGQNLRYIFIPSSIRDYLMLRSAILGVPVPEGPDKGDRPHTYFGPETSAS
KFKLLHPDFISYLTERFLKSKLINTRFGDMYMPSTGALMLLTALHTCDQVSAYGFITNNY
QKYSDHYFEREKKPLIFYANHDLSLEASLWRDLHNAGILWLYQR

Glyco_transf_29

Glyco_transf_29
PFAM accession number:PF00777
Interpro abstract (IPR001675):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-) and related proteins into distinct sequence based families has been described [(PUBMED:9334165)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

Glycosyltransferase family 29 comprises enzymes with a number of known activities; sialyltransferase (EC 2.4.99), beta-galactosamide alpha-2,6-sialyltransferase (EC 2.4.99.1), alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (EC 2.4.99.3), beta-galactoside alpha-2,3-sialyltransferase (EC 2.4.99.4), N-acetyllactosaminide alpha-2,3-sialyltransferase (EC 2.4.99.6), alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase (EC 2.4.99.8); lactosylceramide alpha-2,3-sialyltransferase (EC 2.4.99.9). These enzymes use a nucleotide monophosphosugar as the donor (CMP-NeuA) instead of a nucleotide diphosphosugar.

Sialyltransferase may be responsible for the synthesis of the sequence NEUAC-Alpha-2,3-GAL-Beta-1,3-GALNAC-, found on sugar chains O-linked to thr or ser and also as a terminal sequenec on certain gagnliosides. These enzymes catalyse sialyltransfer reactions during glycosylation, and are type II membrane proteins.

GO process:protein glycosylation (GO:0006486)
GO function:sialyltransferase activity (GO:0008373)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_29