The domain within your query sequence starts at position 36 and ends at position 216; the E-value for the Glyco_transf_4 domain shown below is 2e-18.
CMVSDFFYPNMGGVESHIYQLSQCLIERGHKVITVTHAYGNRKGVRYLTNGLKVYYLPLR VMYNQSTATTLFHSLPLLRYIFVRERITIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHS LFGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDF T
Glyco_transf_4 |
---|
PFAM accession number: | PF13439 |
---|---|
Interpro abstract (IPR028098): | MshA belongs to the GT-B structural family of glycosyltransferases whose members have a two-domain structure with both domains exhibiting a Rossman-type fold [ (PUBMED:18390549) ]. This entry represents the N-terminal domain found in MshA and the subfamily 4 of glycosyltransferases family 1. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_4