The domain within your query sequence starts at position 556 and ends at position 1024; the E-value for the Glyco_transf_41 domain shown below is 1.1e-258.

LRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEANHFIDL
SQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMD
YIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIV
LNGIDLKAFLDSLPDVKIVKMKCPDGGDNPDSSNTALNMPVIPMNTIAEAVIEMINRGQI
QITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDP
STLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRG
QLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKSRQE
YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMW

Glyco_transf_41

Glyco_transf_41
PFAM accession number:PF13844
Interpro abstract (IPR029489):

This entry represents the C-terminal domain of the O-linked beta-N-acetylglucosamine transferase (OGT, also known as UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase), which catalyses the transfer of a single GlcNAc to the Ser or Thr of nucleocytoplasmic proteins [(PUBMED:18948359)]. OGTs have two known domains: the N-terminal tetratricopeptide repeat domain and the C-terminal glycosyltransferase domain [(PUBMED:18536723)]. Deletions of the C-terminal domain result in a complete loss of the enzyme activity [(PUBMED:10753899)].

In animals, OGT is an essential protein that modifies transcription factors, nuclear pore proteins, kinases, and many other proteins. Abnormalities in OGT activities have been associated with type 2 diabetes [(PUBMED:18288188)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_41