The domain within your query sequence starts at position 456 and ends at position 701; the E-value for the Glyco_transf_64 domain shown below is 1.1e-99.

FTAIVLTYDRVESLFRVITEVSKVPSLSKLLVVWNNQNKNPPEESLWPKIRVPLKVVRTA
ENKLSNRFFPYDEIETEAVLAIDDDIIMLTSDELQFGYEVWREFPDRLVGYPGRLHLWDH
EMNKWKYESEWTNEVSMVLTGAAFYHKYFNYLYTYKMPGDIKNWVDTHMNCEDIAMNFLV
ANVTGKAVIKVTPRKKFKCPECTAIDGLSLDQTHMVERSECINKFASVFGTMPLKVVEHR
ADPVLY

Glyco_transf_64

Glyco_transf_64
PFAM accession number:PF09258
Interpro abstract (IPR015338):

This entry represents the C-terminal domain of exostosins (EXTs), which belong to the glycosyltransferase 47 family. In humans, there are five exostosins identified, including EXT1-2, EXTL1-3. They are glycosyltransferases required for the biosynthesis of heparan-sulfate [(PUBMED:11518722)]. They may be tumour suppressors in humans [(PUBMED:11518722)].

EXTL2 catalyses the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans. They are also required for the biosynthesis of heparan-sulphate [(PUBMED:12562774)].

This domain is also found in Arabidopsis glycosyltransferase 64 family members [(PUBMED:16045474)].

GO component:integral component of membrane (GO:0016021)
GO function:transferase activity, transferring glycosyl groups (GO:0016757)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_64