The domain within your query sequence starts at position 369 and ends at position 445; the E-value for the Glyco_transf_7C domain shown below is 9.3e-9.
HKEKAKRKHKTEPYRSPAMAGGLFAIEKDFFFELGLYDPGLQIWGGENFEISYKIWQCGG KLLFVPCSRVGHIYRLE
Glyco_transf_7C |
![]() |
---|
PFAM accession number: | PF02709 |
---|---|
Interpro abstract (IPR027791): | This is the C-terminal domain of a family of galactosyltransferases with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases: N-acetyllactosamine synthase (EC 2.4.1.90), beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase (EC 2.4.1.38), and lactose synthase (EC 2.4.1.22). Note that N-acetyllactosamine synthase is a component of Lactose synthase along with alpha-lactalbumin; in the absence of alpha-lactalbumin (EC 2.4.1.90) is the catalysed reaction [(PUBMED:9435216), (PUBMED:9792633)]. Proteins containing this domain include beta-1,4-galactosyltransferases and N-acetylgalactosaminyltransferases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_7C