The domain within your query sequence starts at position 94 and ends at position 188; the E-value for the Glyco_transf_7N domain shown below is 1.1e-24.

CPDVPPGLVGRVVIEFTSPMPLERVQRENPGVLLGGRYSPPDCTPAQTVAVIIPFRHREH
HLRYWLHYLHPMLRRQRLRYGVYVINQILKTSKRR

Glyco_transf_7N

Glyco_transf_7N
PFAM accession number:PF13733
Interpro abstract (IPR027995):

This entry represents the N-terminal domain of the galactosyltransferases with three related galactosyltransferases activities, all three of which are possessed by one sequence in some cases: N-acetyllactosamine synthase (EC 2.4.1.90), beta-N-acetylglucosaminyl-glycopeptide beta-1,4- galactosyltransferase (EC 2.4.1.38), and lactose synthase (EC 2.4.1.22). Proteins containing this domain include Beta-1,4-galactosyltransferase 1-7, Beta-1,4-N-acetylgalactosaminyltransferase bre-4 and Beta-N-acetyl-D-glucosaminide beta-1,4-N-acetylglucosaminyl-transferase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyco_transf_7N