The domain within your query sequence starts at position 31 and ends at position 105; the E-value for the Glycogen_syn domain shown below is 2.3e-29.
EVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPELKRT LDSMNSKGCKFLAQN
Glycogen_syn |
---|
PFAM accession number: | PF05693 |
---|---|
Interpro abstract (IPR008631): | This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P) [ (PUBMED:11415431) ]. |
GO process: | glycogen biosynthetic process (GO:0005978) |
GO function: | glycogen (starch) synthase activity (GO:0004373) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glycogen_syn