The domain within your query sequence starts at position 23 and ends at position 85; the E-value for the Glycos_trans_3N domain shown below is 1.5e-20.

PELIRLKRDGGHLREADIRNFVHAVIDGRAQDTQIGAMLMAIRLQGMNLEETSVLTRALA
ESG

Glycos_trans_3N

Glycos_trans_3N
PFAM accession number:PF02885
Interpro abstract (IPR017459):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-) and related proteins into distinct sequence based families has been described [(PUBMED:9334165)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

This N-terminal domain is found in various family 3 glycosyl transferases, including anthranilate phosphoribosyltransferase (TrpD, EC 2.4.2.18) and thymidine phosphorylase (EC 2.4.2.2). All these proteins can transfer a phosphorylated ribose substrate. Thymidine phosphorylase catalyses the reversible phosphorolysis of thymidine, deoxyuridine and their analogues to their respective bases and 2-deoxyribose 1-phosphate. This enzyme regulates the availability of thymidine and is therefore essential to nucleic acid metabolism.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glycos_trans_3N