The domain within your query sequence starts at position 114 and ends at position 291; the E-value for the Glycos_transf_2 domain shown below is 2.4e-27.

SIIITFHNEARSTLLRTIRSVLNRTPMHLIQEIILVDDFSNDPEDCKQLIKLPKVKCLRN
NERQGLVRSRMRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINL
DTFNYIESASELRGGFDWSLHFQWEQLSLEQKALRLDPTEPIRTPIIAGGLFVIDKAW

Glycos_transf_2

Glycos_transf_2
PFAM accession number:PF00535
Interpro abstract (IPR001173):

The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases. These enzymes catalyse the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. A classification of glycosyltransferases using nucleotide diphospho-sugar, nucleotide monophospho-sugar and sugar phosphates (EC 2.4.1.-) and related proteins into distinct sequence based families has been described [(PUBMED:9334165)]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. The same three-dimensional fold is expected to occur within each of the families. Because 3-D structures are better conserved than sequences, several of the families defined on the basis of sequence similarities may have similar 3-D structures and therefore form 'clans'.

This domain is found in a diverse family of glycosyl transferases that transfer the sugar from UDP-glucose, UDP-N-acetyl-galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glycos_transf_2