The domain within your query sequence starts at position 95 and ends at position 326; the E-value for the Glycos_transf_3 domain shown below is 3.1e-50.

HQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRSLGHTGGTLDKLESIPGFGVTQ
SPEQMLHILEEVGCCIVGQSAKLVPADGILYAARDVTATVDSVPLITASILSKKAVEGLS
TLVVDVKFGGAAVFPDQEKARELAKMLVRVGVSLGLKVAAALTAMDNPLGRSVGHTLEVE
EALLCLDGAGPPDLRDLVIRLGGAILWISGQAETQDQGAARVAAALDDGSAR

Glycos_transf_3

Glycos_transf_3
PFAM accession number:PF00591
Interpro abstract (IPR000312):

The glycosyl transferase family includes anthranilate phosphoribosyltransferase (TrpD, EC 2.4.2.18) and thymidine phosphorylase (EC 2.4.2.2). All these proteins can transfer a phosphorylated ribose substrate. Thymidine phosphorylase (EC 2.4.2.2) catalyses the reversible phosphorolysis of thymidine, deoxyuridine and their analogues to their respective bases and 2-deoxyribose 1-phosphate. This enzyme regulates the availability of thymidine and is therefore essential to nucleic acid metabolism.

GO process:metabolic process (GO:0008152)
GO function:transferase activity, transferring glycosyl groups (GO:0016757)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glycos_transf_3