The domain within your query sequence starts at position 100 and ends at position 272; the E-value for the Glycos_transf_4 domain shown below is 1.1e-38.
LIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVPKPFRW ILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLVELEGDY RDDHIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGH
Glycos_transf_4 |
---|
PFAM accession number: | PF00953 |
---|---|
Interpro abstract (IPR000715): | This entry represents a family of UDP-GlcNAc/MurNAc: polyisoprenol-P GlcNAc/MurNAc-1-P transferases. Members of the family include eukaryotic N-acetylglucosamine-1-phosphate transferases, which catalyse the conversion of UDP-N-acteyl-D-glucosamine and dolichyl phosphate to UMP and N-acetyl-D-glucosaminyl-diphosphodolichol in the glycosylation pathway; and bacterial phospho-N-acetylmuramoyl-pentapeptide-transferases, which catalyse the first step of the lipid cycle reactions in the biosynthesis of cell wall peptidoglycan. |
GO component: | integral component of membrane (GO:0016021) |
GO function: | phospho-N-acetylmuramoyl-pentapeptide-transferase activity (GO:0008963) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glycos_transf_4