The domain within your query sequence starts at position 143 and ends at position 256; the E-value for the Glyoxalase_2 domain shown below is 2.7e-8.

LAVSDLQKSLNYWSNLLGMKIYEQDEEKQRALLGYADNQCKLELQGIQGAVDHAAAFGRI
AFSCPQKELPDLEDLMKRESHSILTPLVSLDTPGKATVQVVILADPDGHEICFV

Glyoxalase_2

Glyoxalase_2
PFAM accession number:PF12681
Interpro abstract (IPR025870):

This domain is related to the glyoxalase domain (IPR004360).

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glyoxalase_2