The domain within your query sequence starts at position 7 and ends at position 250; the E-value for the Glypican domain shown below is 1e-90.
LLLLLLHLCPGLGPGHGSEAKVVRSCAETRQVLGARGYSLNLIPPSLISGEHLQVCPQEY TCCSSETEQKLIRDAEVTFRGLVEDSGSFLIHTLAARHRKFNEFFREMLSISQHSLAQLF SHSYGRLYSQHAVIFNSLFSGLRDYYEKSGEGLDDTLADFWAQLLERAFPLLHPQYSFPP DFLLCLTRLTSTADGSLQPFGDSPRRLRLQISRALVAARALVQGLETGRNVVSEALKMVS CCWL
Glypican |
---|
PFAM accession number: | PF01153 |
---|---|
Interpro abstract (IPR001863): | Glypicans [ (PUBMED:8589707) (PUBMED:7657705) ] are a family of heparan sulphate proteoglycans which are anchored to cell membranes by a glycosylphosphatidylinositol (GPI) linkage. Six members (GPC1-6) are known in vertebrates [ (PUBMED:11474185) ]. The main function of glypicans is to regulate several signaling pathways, including those of Wnts, Hedgehogs, fibroblast growth factors and bone morphogenetic proteins (BMPs) [ (PUBMED:18505598) (PUBMED:24412155) ]. Structurally, these proteins consist of three separate domains:
|
GO process: | regulation of signal transduction (GO:0009966) |
GO component: | anchored component of plasma membrane (GO:0046658), collagen-containing extracellular matrix (GO:0062023) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Glypican