The domain within your query sequence starts at position 282 and ends at position 348; the E-value for the GnHR_trans domain shown below is 4.6e-27.

RRQTSELHPICNKSISRQDIDDMTQPGDQRVSLVDDEPSYGKGSDMLYSEFDYDLCNEFV
DVTCSPK

GnHR_trans

GnHR_trans
PFAM accession number:PF12369
Interpro abstract (IPR024635):

This domain represents the transmembrane region of follicular stimulating hormone and luteinizing hormone receptors- the two major gonadotropin hormone receptors. This domain is found in eukaryotes, and is approximately 70 amino acids in length. There are two completely conserved C residues that may be functionally important. The transmembrane region is conserved between the two different receptors, while the extracellular ligand binding domains are less well conserved [(PUBMED:18248232)]. The follicular stimulating hormone and luteinizing hormone receptors are G protein-coupled receptors involved in development and maturation of germ cells in both fecund genders.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GnHR_trans