The domain within your query sequence starts at position 24 and ends at position 470; the E-value for the Golgin_A5 domain shown below is 4.3e-147.

DEDDELSQLKESKRAVNSLRDIVDDDDDDDLERVSWTGEPVGSISWSIKETAGSSGSTPE
GREQLKGRNSFYTQLPKPPSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPK
GEYRVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVAL
RHLIHFLKEIGDQKLLLDLFRFLDRAEELALSHYREHLNIQDPEKRKEFLKTCIGLPFSA
EDAAHVQDHYTLLERQIIIEANDRHLESSGQTDIFRKHPRKASILNMPLVTTLFYACFYH
YTESEGTFSSPINLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAP
IGFHRVVEILHKNSAPVQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTCRDLKDRQQLL
AYRSKVDKGSAEEEKIDAILSSSQIRW

Golgin_A5

Golgin_A5
PFAM accession number:PF09787
Interpro abstract (IPR019177):

This entry represents a family of proteins involved in maintaining Golgi structure. They stimulate the formation of Golgi stacks and ribbons, and are involved in intra-Golgi retrograde transport. Two main interactions have been characterised: one with RAB1A that has been activated by GTP-binding and another with isoform CASP of CUTL1 [(PUBMED:12656988)].

GO process:Golgi organization (GO:0007030)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Golgin_A5