The domain within your query sequence starts at position 43 and ends at position 154; the E-value for the Got1 domain shown below is 3.5e-41.

AGIFFSFLGTGLLWLPNGMKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFETTRLLATI
IMLLCLVFTLCAALWWRKKGLALLFCILQFLSMTWYSLSYIPYARDAVLKCC

Got1

Got1
PFAM accession number:PF04178
Interpro abstract (IPR007305):

Traffic through the yeast Golgi complex depends on a member of the syntaxin family of SNARE proteins, Sed5, present in early Golgi cisternae. Got1 is thought to facilitate Sed5-dependent fusion events [(PUBMED:10406798)]. This is a family of sequences derived from eukaryotic proteins. They are similar to a region of a SNARE-like protein required for traffic through the Golgi complex, SFT2 protein (P38166) [(PUBMED:7596416)]. This is a conserved protein with four putative transmembrane helices, thought to be involved in vesicular transport in later Golgi compartments [(PUBMED:10406798)].

GO process:vesicle-mediated transport (GO:0016192)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Got1