The domain within your query sequence starts at position 274 and ends at position 463; the E-value for the Gpi1 domain shown below is 5.1e-79.

RKANMLVSVLLDVALGLLLLSWLHSNNRIGQLANALVPVADRVAEELQHLLQWLMGAPAG
LKMNRALDQVLGRFFLYHIHLWISYIHLMSPFIEHILWHVGLSACLGLTVALSIFSDIIA
LLTFHIYCFYVYGARLYCLKIYGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLF
TILVFLLPTT

Gpi1

Gpi1
PFAM accession number:PF05024
Interpro abstract (IPR007720):

Glycosylphosphatidylinositol (GPI) represents an important anchoring molecule for cell surface proteins. The first step in its synthesis is the transfer of N-acetylglucosamine (GlcNAc) from UDP-N-acetylglucosamine to phosphatidylinositol (PI). This chemically simple step is genetically complex because three or four genes are required in both Saccharomyces cerevisiae (GPI1, GPI2 and GPI3) and mammals (GPI1, PIG A, PIG H and PIG C), respectively [ (PUBMED:11849707) ].

GO process:GPI anchor biosynthetic process (GO:0006506)
GO component:integral component of membrane (GO:0016021)
GO function:phosphatidylinositol N-acetylglucosaminyltransferase activity (GO:0017176)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gpi1