SMART: Pfam domain Gryzun

The domain within your query sequence starts at position 1 and ends at position 155; the E-value for the Gryzun domain shown below is 4e-25.

MCLVPGKTRKLSFKFVAKTEDVGKKIEITSVDLFLGSESGRCVVLSWQGGGGDAASSQEA
LQAARSFKRRPKLAEDEIHWDSVIIQASTMIISRVPNISVHLRHEPPALMNEMYCLVVTV
QSHEKSPIRDVKLTAGLKPGEHPLYKFLLGVRWTR

Gryzun

PFAM accession number:	PF07919
Interpro abstract (IPR012880):	The proteins featured in this family are all eukaryotic, and many of them are annotated as being Gryzun. Gryzun is distantly related to, but distinct from, the Trs130 subunit of the TRAPP complex but is absent from S. cerevisiae. RNAi of human Gryzun ( Q7Z392 ) blocks Golgi exit. Thus the family is likely to be involved with trafficking of proteins through membranes, perhaps as part of the TRAPP complex [ (PUBMED:19942856) ].

PFAM accession number:

PF07919

Interpro abstract (IPR012880):

The proteins featured in this family are all eukaryotic, and many of them are annotated as being Gryzun. Gryzun is distantly related to, but distinct from, the Trs130 subunit of the TRAPP complex but is absent from S. cerevisiae. RNAi of human Gryzun ( Q7Z392 ) blocks Golgi exit. Thus the family is likely to be involved with trafficking of proteins through membranes, perhaps as part of the TRAPP complex [ (PUBMED:19942856) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gryzun