The domain within your query sequence starts at position 1036 and ends at position 1095; the E-value for the Gryzun-like domain shown below is 2.4e-28.

LQNKTDLVQDVEISVEPSDAFMFSGLKQIRLRILPGTKQEMLYNFYPLMAGYQQLPSLNI

Gryzun-like

 Gryzun-like
PFAM accession number:PF12742
Interpro abstract (IPR025876):

This entry represents a domain found in the C-terminal of TRAPPC11 (trafficking protein particle complex subunit 11) protein. TRAPPC11 is involved in endoplasmic reticulum to Golgi apparatus trafficking at a very early stage [ (PUBMED:21525244) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Gryzun-like