The domain within your query sequence starts at position 22 and ends at position 210; the E-value for the Guanylate_cyc_2 domain shown below is 4e-76.

VPIIQQLYHWDCGLACSRMVLRYLGQLDDGEFENALQELQLTRSIWTIDLAYLMRHFGVR
HRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQVHLA
QGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFCRTPDYQGHFIVLRGYNRATGCIF
YNNPAYADR

Guanylate_cyc_2

Guanylate_cyc_2
PFAM accession number:PF09778
Interpro abstract (IPR018616):

GUCD1 contains a guanylyl cyclase domain and is found highly expressed in liver during regeneration [(PUBMED:24743017)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Guanylate_cyc_2