The domain within your query sequence starts at position 41 and ends at position 185; the E-value for the GyrI-like domain shown below is 1e-12.
PPIRNITVAYKFHVGSYGDTGHLFTESCSISPKLRSIAVYYDNPHTVPPEKCRCAVGSIL SEGEESPSPELIHLYQKFGFKIFSFPAPSHVVIATFPYTTPISIWLAARRVHPALDTYIK ERKLCAHPRLEIYHQDKIHFMCPLA
GyrI-like |
---|
PFAM accession number: | PF06445 |
---|---|
Interpro abstract (IPR029442): | This entry represents a small molecule binding domain in a number of different bacterial transcription activators [ (PUBMED:10802742) ] and DNA gyrase inhibitors (GyrI). In members of the GyrI superfamily this domain originated from a dimeric version of an SHS2 module that has been adapted for small-molecule binding [ (PUBMED:15281131) ]. Members of the GyrI superfamily with this domain include a family of secreted forms that is found only in animals and the bacterial pathogen Leptospira [ (PUBMED:15281131) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GyrI-like