SMART: Pfam domain GyrI-like

The domain within your query sequence starts at position 41 and ends at position 185; the E-value for the GyrI-like domain shown below is 1e-12.

PPIRNITVAYKFHVGSYGDTGHLFTESCSISPKLRSIAVYYDNPHTVPPEKCRCAVGSIL
SEGEESPSPELIHLYQKFGFKIFSFPAPSHVVIATFPYTTPISIWLAARRVHPALDTYIK
ERKLCAHPRLEIYHQDKIHFMCPLA

GyrI-like

PFAM accession number:	PF06445
Interpro abstract (IPR029442):	This entry represents a small molecule binding domain in a number of different bacterial transcription activators [ (PUBMED:10802742) ] and DNA gyrase inhibitors (GyrI). In members of the GyrI superfamily this domain originated from a dimeric version of an SHS2 module that has been adapted for small-molecule binding [ (PUBMED:15281131) ]. Members of the GyrI superfamily with this domain include a family of secreted forms that is found only in animals and the bacterial pathogen Leptospira [ (PUBMED:15281131) ].

PFAM accession number:

PF06445

Interpro abstract (IPR029442):

This entry represents a small molecule binding domain in a number of different bacterial transcription activators [ (PUBMED:10802742) ] and DNA gyrase inhibitors (GyrI). In members of the GyrI superfamily this domain originated from a dimeric version of an SHS2 module that has been adapted for small-molecule binding [ (PUBMED:15281131) ]. Members of the GyrI superfamily with this domain include a family of secreted forms that is found only in animals and the bacterial pathogen Leptospira [ (PUBMED:15281131) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GyrI-like