The domain within your query sequence starts at position 159 and ends at position 233; the E-value for the HAD_2 domain shown below is 3.4e-9.

YKETSGLMLDVGGYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAIMIGDDIVG
DVGGAQQCGMRALQV

HAD_2

HAD_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAD_2