The domain within your query sequence starts at position 5 and ends at position 128; the E-value for the HAD_2 domain shown below is 8.9e-7.

LVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKADE
LKRAVTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAAAFHDVFDHVFTN
PASF

HAD_2

HAD_2
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAD_2