The domain within your query sequence starts at position 331 and ends at position 421; the E-value for the HAGH_C domain shown below is 6.2e-23.

EYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEERAYNPFLRTHCLELQ
EALGPGPGPTSDDGCSRAQLLEELRRLKDMH

HAGH_C

HAGH_C
PFAM accession number:PF16123
Interpro abstract (IPR032282):

This domain is found at the C terminus of hydroxyacylglutathione hydrolase enzymes. Substrate binding occurs at the interface between this domain and the catalytic domain (IPR001279) [(PUBMED:10508780), (PUBMED:14529289), (PUBMED:17764159)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAGH_C