The domain within your query sequence starts at position 97 and ends at position 162; the E-value for the HAP1_N domain shown below is 2e-11.

TQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKHELR
RRFENR

HAP1_N

HAP1_N
PFAM accession number:PF04849
Interpro abstract (IPR006933):

This entry represents a N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues. HAP1 binds to huntingtin in a polyglutamine repeat-length-dependent manner. However, its possible role in the pathogenesis of Huntingtons disease is unclear [(PUBMED:7477378), (PUBMED:9599014), (PUBMED:9285789)]. This domain also includes a similar N-terminal conserved region from hypothetical protein products of ALS2CR3 genes found in the human juvenile amyotrophic lateral sclerosis critical region 2q33-2q34 [(PUBMED:11161814)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAP1_N