The domain within your query sequence starts at position 25 and ends at position 130; the E-value for the HATPase_c domain shown below is 8e-8.

SHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVISDHICLTFTDNGNGMTADKLHKMLSFG
FSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAMVFTKNGETMSVGFL

HATPase_c

HATPase_c
PFAM accession number:PF02518
Interpro abstract (IPR003594):

This domain is found in several ATP-binding proteins, including: histidine kinase [(PUBMED:15157101)], DNA gyrase B, topoisomerases [(PUBMED:15105144)], heat shock protein HSP90 [(PUBMED:15292259), (PUBMED:14718169), (PUBMED:15217611)], phytochrome-like ATPases and DNA mismatch repair proteins. The fold of this domain consists of two layers, alpha/beta, which contains an 8-stranded mixed beta-sheet.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HATPase_c