The domain within your query sequence starts at position 29 and ends at position 96; the E-value for the HAUS-augmin3 domain shown below is 7.2e-27.
WLFEDVEDESFLKWFCGNVNEQNVLSEKELEAFSDLQRSGKPILEGTALDEVLRTCKTFD LKTCKLDD
HAUS-augmin3 |
 |
|---|
| PFAM accession number: | PF14932 |
|---|---|
| Interpro abstract (IPR032733): | This domain is found in the HAUS augmin-like complex subunit 3 (HAUS3) [ (PUBMED:19369198) ]. The HAUS-augmin complex (made up of eight subunits) interacts with gamma-TuRC, and attenuation of this interaction severely impairs spindle MT generation. The HAUS complex is required for mitotic spindle assembly and for maintenance of centrosome integrity [ (PUBMED:19427217) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS-augmin3