The domain within your query sequence starts at position 4 and ends at position 67; the E-value for the HAUS2 domain shown below is 1.8e-21.

ANPWDPASSQTAAGLLLNHLVASGIVTKEMLDVSKKMAPCFVNFSRLQQISDIQAEIYQL
RNVM

HAUS2

HAUS2
PFAM accession number:PF15003
Interpro abstract (IPR028346):

This entry represents HAUS augmin-like complex subunit 2 from animals (HAUS2) and plants (AUG2) [(PUBMED:19427217), (PUBMED:22505726)].

The HAUS (Homologous to AUgmin Subunits) individual subunits have been designated HAUS1 to HAUS8 [(PUBMED:19427217)]. In animals, HAUS augmin-like complex subunit 2 is a component of the HAUS augmin-like complex, which localises to the centrosomes and interacts with the gamma-tubulin ring complex (gamma-TuRC) [(PUBMED:14654843)]. The interaction between augmin and gamm-TuRC is important for spindle microtubule generation and affects the mitotic progression and cytokinesis [(PUBMED:19369198)]. HAUS2 may also increase the tension between spindle and kinetochore allowing for chromosome segregation during mitosis [(PUBMED:19369198)]. The HAUS augmin-like complex subunit 2 was previously known as centrosomal protein of 27 kDa (Cep27).

In plants, the augmin complex contains 8 subunits, including two plant-specific subunits [(PUBMED:22505726)]. Despite lacking cetrosomes, the augmin complex in plants plays an important part in gamma-tubulin-dependent MT nucleation and the assembly of microtubule arrays during mitosis [(PUBMED:22505726)].

GO process:microtubule organizing center organization (GO:0031023), spindle assembly (GO:0051225)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS2