The domain within your query sequence starts at position 126 and ends at position 360; the E-value for the HAUS4 domain shown below is 1.5e-87.

QLSGPGQETELPPLLGLERTDLLELMPPSQDFVWMKARLQLEVEEQLKRKCFTLLCYHDP
SSDTDGDTLKAAKVWTLTEVLVREKQQCLEAKSQQKEQLVLLEKKRTTYSQVLLRCLALL
QRLLQEHRLQTKSELDRINAQYLELKCSAMILRLRMEELKVLSDTYSAEKVEMHRLIRDR
LEGAIRLQEQDLEKSRLVLHTYEALGEDFESLVREYTQLRLAADNKRWALQELSK

HAUS4

 HAUS4
PFAM accession number:PF14735
Interpro abstract (IPR029327):

HAUS4 is part of the HAUS augmin-like complex, which contributes to mitotic spindle assembly, maintenance of chromosome integrity and completion of cytokinesis [ (PUBMED:19427217) (PUBMED:19369198) ].

Human augmin complex is composed of 8 subunits and interacts with the gamma-tubulin ring complex (gamma-TuRC) in centrosomes [ (PUBMED:19369198) ]. This interaction affects MT generation during mitosis and is critical for chromosome segregation and cytokinesis in human cells [ (PUBMED:19369198) ].

Similar to humans, Arabidopsis augmin complex also contains 8 subunits, including AUGMIN subunit 4 (AUG4) in this entry [ (PUBMED:22505726) ]. Despite lacking cetrosomes, the augmin complex in Arabidopsis also plays an important part in gamma-tubulin-dependent MT nucleation and the assembly of microtubule arrays during mitosis [ (PUBMED:22505726) ].

GO process:spindle assembly (GO:0051225)
GO component:HAUS complex (GO:0070652)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS4