The domain within your query sequence starts at position 5 and ends at position 515; the E-value for the HAUS5 domain shown below is 4.4e-182.

QKERELSRWAAEEMEVPLAARPRESTLRRLCLSQGADIWAYIVQHVRSQRNIKKIQGNLL
WHAYQDNPKIHRKLELEATVARLRAENQELDQSLELMDQESEAQDVAMTQTLQSLKDTQH
RALLLQAQAGAVRRQQRGLQDPMQRLQNQLKHLQDMQRKAKVDVTFGPVVSAAPALEPEV
LGDVRAACTLRTQFLQNLLTPRARGGSILSPCDDHVGTSYQQWLTSVETLLTNHPAGHVL
AALEYLAAERESEIRSLCYGDGLKEEELSRPQAPESSNSSQVLPSTVHLIQEGWQAVGAL
VTQRSALLSERQVLTGRLQRLVEEVKRLLLGSSERKVLLLGLRHSGLLAELKALHAQSQE
LESAVGQRHLLLRELQAKRQRILQWRQLVEDRQEQIRLLIKGNSASKTRLSRGPEEVLAL
IDQKLVPTSEAVAPQSQELLRCLKEEAKHLPRVLLGPLLPYHVKGLKPLSRILPSIHQLH
PTNPRASSLILLSHTLGLPVGKTSWVSEEEI

HAUS5

HAUS5
PFAM accession number:PF14817
Interpro abstract (IPR029131):

This entry represents HAUS augmin-like complex subunit 5 (HAUS5) from eukaryotes. The HAUS augmin-like complex shares similarity with Drosophila Augmin and contributes to mitotic spindle assembly, maintenance of chromosome integrity and completion of cytokinesis [(PUBMED:19427217), (PUBMED:19369198)].

Plant and animal augmin complexes have similar functions in microtubule nucleation and organisation in mitotic microtubule arrays. The human augmin complex contains 8 subunits [(PUBMED:19427217)]. The Arabidopsis augmin complex contains both conserved and unique subunits compared with its animal counterparts [(PUBMED:22505726)]. This entry includes plant AUG5.

GO process:spindle assembly (GO:0051225)
GO component:HAUS complex (GO:0070652)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS5