The domain within your query sequence starts at position 14 and ends at position 238; the E-value for the HAUS6_N domain shown below is 1.1e-77.
LWMYLQALGLDPSSSITFGGKMVPHAHLGENMFDKLNRDAFHIVSYFLFKTLDEALAKEV FRDCWPPFDQKLDMEFRKHCCEWLKEISAECGSSFPQVVGSLLMSPGGPKFIHLMYHFAR YVAIKYIKTKSNNSLHFAETFNVKPQDMHKCLARSHVARNRFLQILQREHYVMQKYQENV NLSVKQVRNARSECMSLQNQIKRMEPYDEKSNTQEKIQKVRSLWA
HAUS6_N |
---|
PFAM accession number: | PF14661 |
---|---|
Interpro abstract (IPR028163): | This entry represents the N-terminal domain of the subunit 6 of the HAUS augmin-like complex, involved in mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis [ (PUBMED:19369198) (PUBMED:19427217) ]. Subunit 6 interacts with the NEDD1-gamma-tubulin complex and recruits this complex to the spindle, which in turn promotes microtubule polymerisation [ (PUBMED:19029337) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HAUS6_N