The domain within your query sequence starts at position 13 and ends at position 127; the E-value for the HBS1_N domain shown below is 2e-25.
DEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDNPEEEYGYEDLRESSNSLLNHQLSEI DQARLYSCLDHMREVLGDAVPDDILTEAILKHKFDVQKALSVVLEQDGVQPWKEK
HBS1_N |
---|
PFAM accession number: | PF08938 |
---|---|
Interpro abstract (IPR015033): | This domain is found at the N terminus of HBS1 proteins. It interacts with the ribosomal protein rpS3 at the mRNA entry site [ (PUBMED:21623367) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HBS1_N