The domain within your query sequence starts at position 27 and ends at position 767; the E-value for the HCR domain shown below is < 1e-12.

MAPTWASDVPLVQSPASQDVLERRLDAQRSTVTTWGQDFCGDGQGLGRRGRSLELGFSSA
LSQQAELISRQLQELRRLEEEVRSLRETSLQQKMRLETQAVELDALAVAEKAGQAEAEGL
RTALAGAEMVRKNLEEAKHKELEEIQSLHQEQLSSLTQAHQKALDSLASKAEGLEKSLNS
LETKRAGEAKQLAMAQKEADMLRNQLSKTQEELEAQVTLVESLRKYVGEQVLPEFPSQEW
ELERKELLDTLKHLKEDRADLQATVELLQVRVQSLTHMLALQEEELTRKIQPLDPLEPEF
PKKCRSLLRNWREKVFALMVQLKAQDLQHRDSTSQLRIQVAELQEQVTSQSQEQAILQRA
LQDKTAQVEVERMSTKSLQMELDQAQEARRRQEQQIASAEEQLKFVVGAMNSTQAKLQST
MTRMDQAVARIPSLSNRLSYAVRKVHTIKGLMARKVALAQLRVESSPPSEAAPPLDTDLS
VELEQLREERNRLDAELQLSAHLIQQEVGRAREQGEVERRRLIEVAQQLEQELQRAQESL
ASVGQQLEAARRGQQESTEEAASLRQELTQQQEIYGQALQEKVAEVETRLREQLSDTKRR
LNEARREQAKAVVSLRQIQHKATQEKERNQELRRLQDEARKEEGQRLTRRVQELERDKNL
MLQRLLAVLPSGVNKKCSPRSVESSSSESPAAASCKESVKGSLTVLLDNLQGLSEAISRD
EDICVEDNQNTKKTKNPPSDP

HCR

HCR
PFAM accession number:PF07111
Interpro abstract (IPR009800):

This entry represents the coiled-coil alpha-helical rod protein 1 (HCR) from animals. The function of HCR is unknown but it has been implicated in psoriasis in humans and is thought to affect keratinocyte proliferation [(PUBMED:11875053)].

GO process:cell differentiation (GO:0030154)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HCR