The domain within your query sequence starts at position 13 and ends at position 107; the E-value for the HCaRG domain shown below is 4.7e-15.

QKLPPEQGAGTLQQLNQLNSCHQEAVLKCLKSRRNEIKQALLGEIVDISCAQLQDFDWQL
KLALSSDKIATLQMPLLNLHLDVKEDDKVKPYTVE

HCaRG

HCaRG
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HCaRG