The domain within your query sequence starts at position 66 and ends at position 155; the E-value for the HDAC4_Gln domain shown below is 5.1e-37.

PMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLA
AKRQQELEQQRQREQQRQEELEKQRLEQQL

HDAC4_Gln

HDAC4_Gln
PFAM accession number:PF12203
Interpro abstract (IPR024643):

This domain is found in eukaryotic histone deacetylases, and is approximately 90 amino acids in length. The domain forms an alpha helix, which complexes to form a tetramer. The glutamine rich domains have many intra- and inter-helical interactions that are thought to be involved in reversible assembly and disassembly of proteins [(PUBMED:17360518)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HDAC4_Gln