The domain within your query sequence starts at position 67 and ends at position 156; the E-value for the HDAC4_Gln domain shown below is 1.1e-37.
PMDPALREQQLQQELLVLKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQQEMLA AKRQQELEQQRQREQQRQEELEKQRLEQQL
HDAC4_Gln |
---|
PFAM accession number: | PF12203 |
---|---|
Interpro abstract (IPR024643): | This domain is found in eukaryotic histone deacetylases, and is approximately 90 amino acids in length. The domain forms an alpha helix, which complexes to form a tetramer. The glutamine rich domains have many intra- and inter-helical interactions that are thought to be involved in reversible assembly and disassembly of proteins [ (PUBMED:17360518) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HDAC4_Gln