The domain within your query sequence starts at position 1610 and ends at position 1640; the E-value for the HEAT domain shown below is 2.2e-5.

LIVALQLLLKDPVPGVREKAAETLGRLVKFA

HEAT

HEAT
PFAM accession number:PF02985
Interpro abstract (IPR000357):

The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [(PUBMED:7550332)]. Arrays of HEAT repeats consists of 3 to 36 units forming a rod-like helical structure and appear to function as protein-protein interaction surfaces. It has been noted that many HEAT repeat-containing proteins are involved in intracellular transport processes.

In the crystal structure of PP2A PR65/A [(PUBMED:9989501)], the HEAT repeats consist of pairs of antiparallel alpha helices [(PUBMED:7550332)].

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HEAT