The domain within your query sequence starts at position 94 and ends at position 192; the E-value for the HECA domain shown below is 2.8e-42.

PCATPLICSFGRPVDLEKDDYQKVVCNNEHCPCSTWMHLQCFYEWESSILVQFNCIGRAR
SWNEKQCRQNMWTKKGYDLAFRFCSCRCGQGHLKKDTDW

HECA

HECA
PFAM accession number:PF15353
Interpro abstract (IPR026066):

The functions of this group of proteins are unclear. Drosophila headcase(hdc) protein is involved in dendrite pruning [(PUBMED:23197702)] and is a branching inhibitor during tracheal development [(PUBMED:11463742)]. It also promotes cell survival and niche maintenance in the Drosophila testis [(PUBMED:23874487)]. The human headcase protein may be part of the regulatory mechanism in the development of epithelial tube networks such as the circulatory system and lungs and may play an important role in some human cancers [(PUBMED:11696983)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HECA