The domain within your query sequence starts at position 13 and ends at position 364; the E-value for the HECT_2 domain shown below is 2.6e-80.
EVRRRLQSALLILGGPDEGGMHLDISITPTSLLVRTPDGCTEIRLPAGVRLVPSSCGGLQ YISGDGLHLRLRVQAESSPRNSSGCSPCPVRTGALWSESGAAIPTPLLIGLFIREKMTVL LGTLSS
HECT_2 |
---|
PFAM accession number: | PF09814 |
---|---|
Interpro abstract (IPR019193): | This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [ (PUBMED:15749827) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HECT_2