The domain within your query sequence starts at position 65 and ends at position 184; the E-value for the HECW_N domain shown below is 6.5e-62.

RSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIGEVSSEN
FLDYKNRGVNGSHRGQIIWKIDASSYFVESETKICFKYYHGVSGALRATTPSVTVKNSAA

HECW_N

HECW_N
PFAM accession number:PF16562
Interpro abstract (IPR032348):

This entry represents a domain found in E3 ubiquitin-protein ligases HECW1 and HECW2 that lies upstream of the C2 domain. Its function is not clearly understood, but it might be to determine the substrate spectrum of the ligase [(PUBMED:23545411)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HECW_N