The domain within your query sequence starts at position 1335 and ends at position 1410; the E-value for the HELP domain shown below is 2.4e-16.

RDCRNNVHYLNDGDDIIYHTASIGILHNVATGTQSFYQEHNDDILCLTVNQHPKFINIVA
TGQVGIFYLCAATAPS

HELP

HELP
PFAM accession number:PF03451
Interpro abstract (IPR005108):

The HELP (Hydrophobic ELP) domain is found in EMAP and EMAP-like proteins (ELPs) [(PUBMED:11694528), (PUBMED:7989351)]. Although called a domain it contains a predicted transmembrane helix and may not form a globular domain. It is also not clear if these proteins localize to membranes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HELP