The domain within your query sequence starts at position 17 and ends at position 168; the E-value for the HEM4 domain shown below is 5.1e-20.
DPYIQELRLCGLEATLIPVLSFEFMSLPSLSEKLSHPEGFGGLIFTSPRAVEAVKLCLEK DNKTEAWEKSLKDRWNAKSVYVVGSATASLVNKIGLDAEGAGSGNAEKLAEYICSNGLLG EQRSRSHAPGSLQLRQKCASQFLPTSGAAALS
HEM4 |
---|
PFAM accession number: | PF02602 |
---|---|
Interpro abstract (IPR003754): | Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [ (PUBMED:16564539) ]. The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin [ (PUBMED:17227226) ].
This entry represents uroporphyrinogen III synthase ( EC 4.2.1.75 ) which functions during the second stage of tetrapyrrole biosynthesis. This enzyme catalyses the inversion of the final pyrrole unit (ring D) of the linear tetrapyrrole molecule, linking it to the first pyrrole unit (ring A), thereby generating a large macrocyclic structure called uroporphyrinogen III [ (PUBMED:11215515) ]. The enzyme folds into two alpha/beta domains connected by a beta-ladder, the active site being located between the two domains [ (PUBMED:11689424) ]. Congenital erythropoietic porphyria (CEP) is an autosomal recessive inborn error of metabolism that results from the markedly deficient activity of uroporphyrinogen III synthase [ (PUBMED:17270473) ]. |
GO process: | tetrapyrrole biosynthetic process (GO:0033014) |
GO function: | uroporphyrinogen-III synthase activity (GO:0004852) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HEM4