The domain within your query sequence starts at position 594 and ends at position 685; the E-value for the HGTP_anticodon domain shown below is 5.4e-20.
QVVVIPVRTEQEEYARQVQQCLQAAGLVSDLDADSGLTLSRRVRRAQLAHYNFQFVVGQR EQSQRTVNVRTRDNRQLGERDLAESVQRLLEL
HGTP_anticodon |
---|
PFAM accession number: | PF03129 |
---|---|
Interpro abstract (IPR004154): | tRNA synthetases, or tRNA ligases are involved in protein synthesis. This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases [ (PUBMED:10447505) ]. It is probably the anticodon binding domain [ (PUBMED:9115984) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry HGTP_anticodon