The domain within your query sequence starts at position 371 and ends at position 470; the E-value for the HGTP_anticodon domain shown below is 8.7e-12.

QVCVIPPKKGSKETAATEIVEKLYDDIMEAVPQLRGEVLLDDRTHLTIGNRLKDANKLGY
PFVIIAGKRALEDPAHFEVWSQNTGEVVFLTKEGVMELLT

HGTP_anticodon

HGTP_anticodon
PFAM accession number:PF03129
Interpro abstract (IPR004154):

tRNA synthetases, or tRNA ligases are involved in protein synthesis. This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases [(PUBMED:10447505)]. It is probably the anticodon binding domain [(PUBMED:9115984)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry HGTP_anticodon